PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g16980.1
Common NameLR48_Vigan03g278200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRAS
Protein Properties Length: 624aa    MW: 72064.2 Da    PI: 5.9839
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g16980.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS260.36.9e-802526212374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfs 94 
                      + Ll++Ae v  +++e+a++lL + + ++sp+  +p+qR++++f++AL++r+ r  + +++k  + +e++e  ++  +++  +f++  P+ ++ 
  Vang04g16980.1 252 AQFLLAAAERVGCHQFERASRLLLHCQLNSSPNNgSPVQRVIFHFAQALRERIDRgLGRTTAKGSEKKEEREWIQKIDTNVALTFHQNIPFNQVM 346
                     5789*************************9987769*******************44444454444444443335555666677*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++t  q+I+e v++e+++H+iDf+   G++   L+qaL++R+  +   l+iT+++ ++   + +++etg+rLa+fAe+l++pf +n++ ++++++
  Vang04g16980.1 347 QFTGIQTIVEHVASETKIHVIDFETICGVHNTILMQALTERQdCKVQLLKITALALNS--CRSMIQETGKRLASFAESLNLPFLYNAVFVTDFAE 439
                     ******************************************556679********55..*********************************** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++  ++++ +gEa+aV + + l  +++++ ++e+    +++++++++P +++v e ea+hns+ F++rf+eal +ysa fd+l + +  e+e r+
  Vang04g16980.1 440 IREGDFEIGEGEAVAVYSPYFLRCMVSRPDCMEN----LMRVIWNMKPVIMIVLEVEANHNSPIFVNRFIEALFFYSAYFDCLGSCINDENESRR 530
                     *************************988888888....********************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     k+E + l++ i+++va+eg+er+ r+ +   Wr+ + +  + +  +se+   qa+l+ ++++ ++  ++e++ ++++ gWk+ p+ svSaWr
  Vang04g16980.1 531 KIETV-LSEGIREIVAMEGRERKVRNVKIDVWRKFFARYRMVETGFSESSLYQAHLVNKEFAfGKFCTLEKNGKCIIVGWKGTPVHSVSAWR 621
                     ****9.********************************************************777789999999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.604225600IPR005202Transcription factor GRAS
PfamPF035142.4E-77252621IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MRTSRTSSSE LHVPITFMNF VIILFFDHLY VQIFLFHLDR GNGYPLPYVY LDKHNFLINY  60
VNMENDQFSS TALNLREILV GYGSTQEDVF QEKESFSGME LLGPIEDEKG TKLFEDEDQK  120
QLQEPQVYKL LEVFNCDYDM QLKPTPQFDE TTWPAKHDIE SAEHNNHVSP SLASLELLRN  180
YRSRFKRISE QNIAKPSLDH HQISTEEIIR VAGARYVQYS AHWNDSFCIP MHPYGLDFGC  240
LSEEENRDVE LAQFLLAAAE RVGCHQFERA SRLLLHCQLN SSPNNGSPVQ RVIFHFAQAL  300
RERIDRGLGR TTAKGSEKKE EREWIQKIDT NVALTFHQNI PFNQVMQFTG IQTIVEHVAS  360
ETKIHVIDFE TICGVHNTIL MQALTERQDC KVQLLKITAL ALNSCRSMIQ ETGKRLASFA  420
ESLNLPFLYN AVFVTDFAEI REGDFEIGEG EAVAVYSPYF LRCMVSRPDC MENLMRVIWN  480
MKPVIMIVLE VEANHNSPIF VNRFIEALFF YSAYFDCLGS CINDENESRR KIETVLSEGI  540
REIVAMEGRE RKVRNVKIDV WRKFFARYRM VETGFSESSL YQAHLVNKEF AFGKFCTLEK  600
NGKCIIVGWK GTPVHSVSAW RFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2528162132375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495056.10.0PREDICTED: uncharacterized protein LOC106756979
TrEMBLA0A0L9U9620.0A0A0L9U962_PHAAN; Uncharacterized protein
STRINGGLYMA19G40440.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-42RGA-like 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]